Basic Information | |
---|---|
IMG/M Taxon OID | 3300012844 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0191474 | Ga0160475 |
Sample Name | Enriched soil microbial communities from UW Madison campus, WI, USA - HID1975M_E11 MG |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 48887561 |
Sequencing Scaffolds | 0 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Porifera Rhopaloeides Odorabile Microbial Communities From Palm Island, Great Barrier Reef |
Type | Host-Associated |
Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Rhopaloeides Odorabile → Porifera Rhopaloeides Odorabile Microbial Communities From Palm Island, Great Barrier Reef |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → university campus → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Madison, Wisconsin | |||||||
Coordinates | Lat. (o) | -18.68 | Long. (o) | -89.4011 | Alt. (m) | N/A | Depth (m) | 8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081732 | Metagenome / Metatranscriptome | 114 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0160475_119433 | Ga0160475_1194332 | F081732 | LLVTEKTHIGGFILTTLKKLNGLKLILPYLSIVDAKHIGRGAMAACK* |
⦗Top⦘ |