| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300012844 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0191474 | Ga0160475 |
| Sample Name | Enriched soil microbial communities from UW Madison campus, WI, USA - HID1975M_E11 MG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 48887561 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Porifera Rhopaloeides Odorabile Microbial Communities From Palm Island, Great Barrier Reef |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Porifera Rhopaloeides Odorabile → Porifera Rhopaloeides Odorabile Microbial Communities From Palm Island, Great Barrier Reef |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → university campus → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Madison, Wisconsin | |||||||
| Coordinates | Lat. (o) | -18.68 | Long. (o) | -89.4011 | Alt. (m) | N/A | Depth (m) | 8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081732 | Metagenome / Metatranscriptome | 114 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0160475_119433 | Ga0160475_1194332 | F081732 | LLVTEKTHIGGFILTTLKKLNGLKLILPYLSIVDAKHIGRGAMAACK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |