x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300012831
3300012831: Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG
Overview
| Basic Information |
| IMG/M Taxon OID | 3300012831 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0121620 | Gp0191442 | Ga0160459 |
| Sample Name | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 86322778 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | USA: Madison, Wisconsin |
| Coordinates | Lat. (o) | 43.073 | Long. (o) | -89.4011 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F020217 | Metagenome / Metatranscriptome | 225 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0160459_109891 | Ga0160459_1098912 | F020217 | MKAQFETSVPGEAGITSQIREFFRRYGANFVDLTIGKRSDVDALLEFYGAPLRFIGSTFHRVMNDSAAITGADGMGGEIDRLRRAGFAGSTLDKCQISVLNSRAALVDALWLRRDGAGALMARFGVIYLMTLTTSGWRITSAVNTSE* |
