NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012824

3300012824: Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG



Overview

Basic Information
IMG/M Taxon OID3300012824 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121620 | Gp0191458 | Ga0160469
Sample NameEnriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size84891590
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCharacterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
TypeHost-Associated
TaxonomyHost-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationUSA: Madison, Wisconsin
CoordinatesLat. (o)43.073Long. (o)-89.4011Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063045Metagenome / Metatranscriptome130Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0160469_118936Not Available537Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0160469_118936Ga0160469_1189361F063045MNKLIASVVFVFALIPLAHAQETIGDKAQEVKGEAVQAKRAAGANIREAGREVKSTARKADRAVRTLCADGRHTIKGAAGCEGHGGVSRTN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.