Sample 3300012824

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300012824

3300012824: Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG

Overview

Basic Information
IMG/M Taxon OID	3300012824 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121620 \| Gp0191458 \| Ga0160469
Sample Name	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	84891590
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities
Type	Host-Associated
Taxonomy	Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Insecta → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	USA: Madison, Wisconsin
Coordinates	Lat. (^o)	43.073	Long. (^o)	-89.4011	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063045	Metagenome / Metatranscriptome	130	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0160469_118936	Not Available	537	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0160469_118936	Ga0160469_1189361	F063045	MNKLIASVVFVFALIPLAHAQETIGDKAQEVKGEAVQAKRAAGANIREAGREVKSTARKADRAVRTLCADGRHTIKGAAGCEGHGGVSRTN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.