NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300012736

3300012736: Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES021 metaT (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300012736 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0126301 | Gp0177774 | Ga0157535
Sample NameOligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES021 metaT (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size5246627
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomeoligotrophic lakelake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)46.008Long. (o)-89.701Alt. (m)N/ADepth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080816Metagenome / Metatranscriptome114Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0157535_110646Not Available523Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0157535_110646Ga0157535_1106461F080816SPKTKQTTKGIIEMKKIVMNLAVALVGLFGTTSANATVYFQSDFNGLDPATKVINGGLLSLSAYGVPNQWGIVRDNALTIYGGDPHNGASSARLVGLGTDLANGLSLLRMTGEYRTKSAWDGSPFATTAKIEYQNNEWYFDYNKLVVNASTPGWTSFTLDLNLAGLATDAPHID

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.