Sample 3300012335

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300012335

3300012335: Human skin bacterial and viral communities - University of Pennsylvania - MG100308

Overview

Basic Information
IMG/M Taxon OID	3300012335 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118646 \| Gp0137977 \| Ga0118040
Sample Name	Human skin bacterial and viral communities - University of Pennsylvania - MG100308
Sequencing Status	Permanent Draft
Sequencing Center	University of Pennsylvania
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	20540674
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Skin Bacterial And Viral Communities - University Of Pennsylvania
Type	Host-Associated
Taxonomy	Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal surface

Location Information
Location
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0118040_106251	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	770	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118040_106251	Ga0118040_1062511	F060965	VYPAIRAIRYSSINNVKLTLALLMTRFDANYSNDALALDDLTVAADPLN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.