NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011910

3300011910: Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - JXZ_IW_meta



Overview

Basic Information
IMG/M Taxon OID3300011910 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118583 | Gp0137235 | Ga0119893
Sample NameWastewater microbial communities from municipal sewage treatment plant in Nanjing, China - JXZ_IW_meta
Sequencing StatusPermanent Draft
Sequencing CenterNanjing University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size41928486
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana2
All Organisms → cellular organisms → Eukaryota1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameWastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China
TypeEngineered
TaxonomyEngineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Municipal Sewage Treatment Plants In Nanjing, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationChina: Nanjing
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000331Metagenome / Metatranscriptome1285Y
F006296Metagenome / Metatranscriptome376Y
F059945Metagenome / Metatranscriptome133Y
F062748Metagenome / Metatranscriptome130N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0119893_100406All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana4676Open in IMG/M
Ga0119893_108272All Organisms → cellular organisms → Eukaryota929Open in IMG/M
Ga0119893_115060All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana640Open in IMG/M
Ga0119893_118503Not Available570Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0119893_100406Ga0119893_1004064F059945MRSGVHVVCFYMHARRVVSRFDAKGHQELSGYELYESLLTYVAHMDLVGDPLQDTCHARASKILITRIRKILYVGYRRIFP*
Ga0119893_108272Ga0119893_1082721F006296VPRKASEVGACKELEGHIFTIGSGNKGKDGDMLRTSMEKMTTYIGTKFGDKAAQEWISGKKIVPTEPTYSQAIKTRHAARVKATKDRIDLRLRGLTTEKAAIQAELLGSPSDRTLLRELREVEDQLAKAEIELINEVDMKLTEDEKISHANAWRSHRETTESLKKSRGKVYSLLFGQCTQVLVDKMKQVMDWVAISESFDPTLLFKLIEKFVLKQFDNQYATAVLIAEQLSILSFRQDDHLGNAGYYDRFT
Ga0119893_115060Ga0119893_1150601F000331PTTVRNPQANAILERVHQVIGQMLRTAELDMAKSVVPDDVDVFIDNAAWAICSTYHTVLKASPGAAIFGRDMLFDIPFLADWNKIGDYRQSCSVKRENSKRIDYDYKVGDKVLIVKEGILCKAESRYGKEPWTITTVHTNGTIRVQCGSKSERINIRRVTPFSEDII*
Ga0119893_118503Ga0119893_1185031F062748LKAYITIVQERYPTLKYFKVGALKSLPGAKSQYVGHGRKLHSDYPQSVEELEPRFRPVSIIVGLNSFNFMWLNDRTSRESDIRKMTVYPGEMIMFTNHCLHAGGENNTNEEQTRLFAYLASDESHFPSGEVTTWDWQRGDNDPLISKPSSTANTALIRRPGTNQIRLITGRVATSIGRGTDR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.