Sample 3300011557

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300011557

3300011557: Permafrost microbial communities from the Kolyma-Indigirka Lowland, Siberia, Russia - IC8_1M_join_R1

Overview

Basic Information
IMG/M Taxon OID	3300011557 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114369 \| Gp0137591 \| Ga0120177
Sample Name	Permafrost microbial communities from the Kolyma-Indigirka Lowland, Siberia, Russia - IC8_1M_join_R1
Sequencing Status	Permanent Draft
Sequencing Center	Institute of Physicochemical and Biological Problems in Soil Science
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	11064975
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Permafrost Microbial Communities From The Kolyma-Indigirka Lowland, Siberia, Russia
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From The Kolyma-Indigirka Lowland, Siberia, Russia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	polar biome → polar → permafrost
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Russia: Siberia
Coordinates	Lat. (^o)	68.716667	Long. (^o)	158.9	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056720	Metagenome	137	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0120177_102857	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	538	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120177_102857	Ga0120177_1028571	F056720	MNFAPRMPTIIVALVLVLIGLLGTFGGMLPSVAGMSSETLGAWSFVVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.