| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300011273 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053074 | Gp0054909 | Ga0138352 |
| Sample Name | Marine microbial communities from the Deep Pacific Ocean - MP1492 (Metagenome Metatranscriptome) (version 2) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 9879757 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -25.2939 | Long. (o) | -179.3141 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| F063612 | Metatranscriptome | 129 | Y |
| F076161 | Metagenome / Metatranscriptome | 118 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0138352_101508 | Not Available | 955 | Open in IMG/M |
| Ga0138352_108486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1 | 767 | Open in IMG/M |
| Ga0138352_112260 | Not Available | 771 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0138352_101508 | Ga0138352_1015081 | F063612 | APKSVAGGSPADDAALVAEESGLKIPRREAASEEDVYSPAL* |
| Ga0138352_108486 | Ga0138352_1084861 | F076161 | MKSINFSSRCPKTGFRAFAEKPAAKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIATNPKERSNLLSSPTNPDAPTGKPI* |
| Ga0138352_112260 | Ga0138352_1122602 | F030135 | REELATLSSFTNIWHSTFAGCQFPDAILPGKEAIDLVAGPLN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |