NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011273

3300011273: Marine microbial communities from the Deep Pacific Ocean - MP1492 (Metagenome Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300011273 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054909 | Ga0138352
Sample NameMarine microbial communities from the Deep Pacific Ocean - MP1492 (Metagenome Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size9879757
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin11

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)-25.2939Long. (o)-179.3141Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030135Metagenome / Metatranscriptome186Y
F063612Metatranscriptome129Y
F076161Metagenome / Metatranscriptome118N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0138352_101508Not Available955Open in IMG/M
Ga0138352_108486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha1_Bin1767Open in IMG/M
Ga0138352_112260Not Available771Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0138352_101508Ga0138352_1015081F063612APKSVAGGSPADDAALVAEESGLKIPRREAASEEDVYSPAL*
Ga0138352_108486Ga0138352_1084861F076161MKSINFSSRCPKTGFRAFAEKPAAKSLLLPQFGGQKMPPQGASIPNRLTAWTVPQIATNPKERSNLLSSPTNPDAPTGKPI*
Ga0138352_112260Ga0138352_1122602F030135REELATLSSFTNIWHSTFAGCQFPDAILPGKEAIDLVAGPLN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.