NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011195

3300011195: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 4 - S13.1.30.a - transect 1, age 5 years, surface depth)



Overview

Basic Information
IMG/M Taxon OID3300011195 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121480 | Gp0155454 | Ga0137469
Sample NameArctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 4 - S13.1.30.a - transect 1, age 5 years, surface depth)
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Bristol
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size6405001
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes Of Arctic Soils
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeglacial featuresoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationNorway: Midre Lovenbreen, Svalbard
CoordinatesLat. (o)79.11833333Long. (o)12.09361111Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069065Metagenome124Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0137469_101533Not Available561Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0137469_101533Ga0137469_1015331F069065MARVNGKAGFWGRVGSAFERSDIGSDSVDDADDADAVRPTTTRYAPIRQAVERRIKSFLRQDVVSHLEIGFNEVFLLHYIEIAADRQGNEELEQFLEEFPPDSRVHWVKKLLGPAVGQYVKVDQFLGLDKEFSAEELAETDPFEEKLNQAAQALYRVILHGRWESGGPAVDSP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.