x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300011195
3300011195: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 4 - S13.1.30.a - transect 1, age 5 years, surface depth)
Overview
Basic Information |
IMG/M Taxon OID | 3300011195 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121480 | Gp0155454 | Ga0137469 |
Sample Name | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 4 - S13.1.30.a - transect 1, age 5 years, surface depth) |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Bristol |
Published? | Y |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 6405001 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Metagenomes Of Arctic Soils |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | terrestrial biome → glacial feature → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information |
Location | Norway: Midre Lovenbreen, Svalbard |
Coordinates | Lat. (o) | 79.11833333 | Long. (o) | 12.09361111 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F069065 | Metagenome | 124 | Y |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0137469_101533 | Ga0137469_1015331 | F069065 | MARVNGKAGFWGRVGSAFERSDIGSDSVDDADDADAVRPTTTRYAPIRQAVERRIKSFLRQDVVSHLEIGFNEVFLLHYIEIAADRQGNEELEQFLEEFPPDSRVHWVKKLLGPAVGQYVKVDQFLGLDKEFSAEELAETDPFEEKLNQAAQALYRVILHGRWESGGPAVDSP |