NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011193

3300011193: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 12 - S13.3.50.a - transect 3, age 50 years, surface depth).



Overview

Basic Information
IMG/M Taxon OID3300011193 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121480 | Gp0155465 | Ga0137477
Sample NameArctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 12 - S13.3.50.a - transect 3, age 50 years, surface depth).
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Bristol
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size4751816
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes Of Arctic Soils
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeglacial featuresoil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationMidre Lovenbreen, Svalbard, Norway
CoordinatesLat. (o)78.90777778Long. (o)12.16444444Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011197Metagenome / Metatranscriptome294Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0137477_100439All Organisms → cellular organisms → Bacteria657Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0137477_100439Ga0137477_1004391F011197RGVAAVAPYDSPGFRSPDWVGFQWDSVDTRAVAYPGLPGRWRGAPYDFVDGGEGLDIAGLPDEVLGCLAGT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.