x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300011193
3300011193: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 12 - S13.3.50.a - transect 3, age 50 years, surface depth).
Overview
Basic Information |
IMG/M Taxon OID | 3300011193 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121480 | Gp0155465 | Ga0137477 |
Sample Name | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 12 - S13.3.50.a - transect 3, age 50 years, surface depth). |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Bristol |
Published? | Y |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 4751816 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Metagenomes Of Arctic Soils |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | terrestrial biome → glacial feature → soil |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information |
Location | Midre Lovenbreen, Svalbard, Norway |
Coordinates | Lat. (o) | 78.90777778 | Long. (o) | 12.16444444 | Alt. (m) | N/A | Depth (m) | 0 |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F011197 | Metagenome / Metatranscriptome | 294 | Y |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0137477_100439 | Ga0137477_1004391 | F011197 | RGVAAVAPYDSPGFRSPDWVGFQWDSVDTRAVAYPGLPGRWRGAPYDFVDGGEGLDIAGLPDEVLGCLAGT* |