Sample 3300010963

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300010963

3300010963: Subsoil microbial communities from Rio Tinto Huelva, Spain - T211

Overview

Basic Information
IMG/M Taxon OID	3300010963 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0121592 \| Gp0156615 \| Ga0138108
Sample Name	Subsoil microbial communities from Rio Tinto Huelva, Spain - T211
Sequencing Status	Permanent Draft
Sequencing Center	Autonomous University of Barcelona
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	18640120
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Subsoil Microbial Communities From Rio Tinto Huelva, Spain
Type	Environmental
Taxonomy	Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Subsoil → Subsoil Microbial Communities From Rio Tinto Huelva, Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → land → soil
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Huelva, Spain
Coordinates	Lat. (^o)	37.26	Long. (^o)	-6.94	Alt. (m)	N/A	Depth (m)	250
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021823	Metagenome / Metatranscriptome	217	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0138108_100254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	12388	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0138108_100254	Ga0138108_1002545	F021823	MNAFVRRFVMHYGIYRRYPLARIDALRNAWRIARA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.