x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300010384
3300010384: Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week5, replicate 2
Overview
| Basic Information |
| IMG/M Taxon OID | 3300010384 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0121424 | Gp0154111 | Ga0136217 |
| Sample Name | Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week5, replicate 2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Fidelity Systems Inc |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 164806877 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | Bangor area, North Wales, UK |
| Coordinates | Lat. (o) | 53.24 | Long. (o) | -4.01 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F022892 | Metagenome / Metatranscriptome | 212 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0136217_1049981 | Ga0136217_10499811 | F022892 | MVNKKIKPRAKSRGVLKSREPPHRVANQLKILIPVGTAIIIVAAVK* |
