Sample 3300010264

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300010264

3300010264: Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4571-4 33-36 cm metaG

Overview

Basic Information
IMG/M Taxon OID	3300010264 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111485 \| Gp0138780 \| Ga0116201
Sample Name	Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4571-4 33-36 cm metaG
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	13337508
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → marine sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Mexico: Guaymas Basin, Gulf of California
Coordinates	Lat. (^o)	27.0078	Long. (^o)	-111.4071	Alt. (m)	N/A	Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007460	Metagenome	350	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0116201_100001	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	25017	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116201_100001	Ga0116201_10000124	F007460	MVDGGGEGIGTAVFATMLGIVFAIIFFMLVGSVMCGILPPLTSIVGLGEASPFAEALTAVPTLVNAFFYLPLVWVVVLFAWLFKYVVKRHRYTYYERGGEEEW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.