x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300010244
3300010244: Processed tobacco microbial communities from Atlanta, GA, USA - retail point 1 - domestic moist snuff M6 re-assembly
Overview
| Basic Information |
| IMG/M Taxon OID | 3300010244 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0111475 | Gp0104062 | Ga0136508 |
| Sample Name | Processed tobacco microbial communities from Atlanta, GA, USA - retail point 1 - domestic moist snuff M6 re-assembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Centers for Disease Control and Prevention (CDC), USA |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 29071363 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Processed Tobacco Microbial Communities From Domestic Moist Snuff Usa |
| Type | Engineered |
| Taxonomy | Engineered → Food Production → Unclassified → Unclassified → Unclassified → Processed Tobacco → Processed Tobacco Microbial Communities From Domestic Moist Snuff Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant corpus |
| Location Information |
| Location | Atlanta |
| Coordinates | Lat. (o) | 33.881 | Long. (o) | -84.294 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F045048 | Metagenome / Metatranscriptome | 153 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0136508_10449 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 11159 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0136508_10449 | Ga0136508_104491 | F045048 | VTPDDNNKTVFNKGNSKGFTACIPNGGHCAPNSTLGDIALWKNAQKIAKKKNASETMNKPTPRFNPFCTAFV* |
