| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010241 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121458 | Gp0154501 | Ga0136483 |
| Sample Name | Marine sediment microbial community from clay sediment within the South China Sea |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Oregon State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 6773629 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanophagales → unclassified Methanophagales → Methanophagales archaeon | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South China Sea | |||||||
| Coordinates | Lat. (o) | 12.91889 | Long. (o) | 115.04722 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016493 | Metagenome / Metatranscriptome | 246 | Y |
| F071959 | Metagenome / Metatranscriptome | 121 | Y |
| F100366 | Metagenome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0136483_101237 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanophagales → unclassified Methanophagales → Methanophagales archaeon | 679 | Open in IMG/M |
| Ga0136483_102022 | Not Available | 580 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0136483_101237 | Ga0136483_1012372 | F016493 | FGDKIGKFRQVSDPYFSMHITGKFLFGMGLGLLLAIWLPIWIGWVFIVASLLIAIPSARIILGK* |
| Ga0136483_102022 | Ga0136483_1020221 | F071959 | MSLSDKKNYRTKALAAGLERCKHASIGSIEADIPVLATIKDADKADRVAAIEAYIKTGAWPVTIDQRELAPLTDLVVAAAQDSWLTAALAVICTAYTCLNAVAAPQLIVGKLMVCYGISVESAVVPMPVSRLTFRKGGVAGNIQAQFDMEPMGVRLETDAFFSEPVIIDPNAVFALQV |
| Ga0136483_102303 | Ga0136483_1023031 | F100366 | QFKTYNFQKTSEDILPHHCLGLNGPELMRAMEVVHKVEKAKGEVSLTENDYRLIVDTCTKFRGFQKFDERFLERIYKCPIIPDEVLKIPDNGNGKEKK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |