x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300010224
3300010224: Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week1, replicate 2
Overview
Basic Information |
IMG/M Taxon OID | 3300010224 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121424 | Gp0154107 | Ga0136213 |
Sample Name | Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week1, replicate 2 |
Sequencing Status | Permanent Draft |
Sequencing Center | Fidelity Systems Inc |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 95618183 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
Type | Engineered |
Taxonomy | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information |
Location | Bangor area, North Wales, UK |
Coordinates | Lat. (o) | 53.24 | Long. (o) | -4.01 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F059118 | Metagenome | 134 | N |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0136213_1000113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 44696 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0136213_1000113 | Ga0136213_10001136 | F059118 | MLLIALMMGGILDNPPVHDPLVPPTRVTTSFTCHGTQRTITVAHGIGRDAVVSLTANGKPVVGTAMTAIRSGLAPLTAIDDVTPYCGDGPDRIRIKGWIEDKKRNLMIFFGPGGQAAVRDVG* |