x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300010221
3300010221: Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 1
Overview
| Basic Information |
| IMG/M Taxon OID | 3300010221 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0121426 | Gp0154196 | Ga0136259 |
| Sample Name | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Fidelity Systems Inc |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 102662290 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Freshwater Microbial Communities Enriched With Nitrile Substrates |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates |
| Location Information |
| Location | Bangor, North Wales, UK |
| Coordinates | Lat. (o) | 53.23 | Long. (o) | -4.13 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F025287 | Metagenome / Metatranscriptome | 202 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0136259_112149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1007 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0136259_112149 | Ga0136259_1121492 | F025287 | MGKDMIVSVDVYTKDVDAALAAFKLAIESGATNVRLSSNEDYDTKKFENLNLMFEANHTSAAISKLDEGPXXXXXX |
