NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010221

3300010221: Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 1



Overview

Basic Information
IMG/M Taxon OID3300010221 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121426 | Gp0154196 | Ga0136259
Sample NameFreshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 1
Sequencing StatusPermanent Draft
Sequencing CenterFidelity Systems Inc
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size102662290
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Microbial Communities Enriched With Nitrile Substrates
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomeaquiferfresh water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationBangor, North Wales, UK
CoordinatesLat. (o)53.23Long. (o)-4.13Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025287Metagenome / Metatranscriptome202Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136259_112149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales1007Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136259_112149Ga0136259_1121492F025287MGKDMIVSVDVYTKDVDAALAAFKLAIESGATNVRLSSNEDYDTKKFENLNLMFEANHTSAAISKLDEGPXXXXXX

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.