Sample 3300010204

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300010204

3300010204: Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCF4

Overview

Basic Information
IMG/M Taxon OID	3300010204 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0120452 \| Gp0154475 \| Ga0136456
Sample Name	Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FCF4
Sequencing Status	Permanent Draft
Sequencing Center	Marine Biological Laboratory
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	43377308
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Phototrophic Microbial Communities
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater lake biome → freshwater littoral zone → lake sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	Lake Waban, Wellesley MA
Coordinates	Lat. (^o)	42.2876	Long. (^o)	-71.30117	Alt. (m)	N/A	Depth (m)	.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017253	Metagenome	242	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0136456_104031	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae	3343	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0136456_104031	Ga0136456_1040312	F017253	MSIYANDRVALTLAPNVGSYTQGRTAGDFLSSRKAARAERCTPKTTAADLDG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.