| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010009 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120461 | Gp0151274 | Ga0133908 |
| Sample Name | Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #4 sample H4 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Maryland |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 27010469 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Black Band Disease Transitions |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal surface |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Belize: Carrie Bow Cay Field Station | |||||||
| Coordinates | Lat. (o) | 16.80288 | Long. (o) | -88.08213 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096744 | Metagenome / Metatranscriptome | 104 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0133908_103822 | Not Available | 1392 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0133908_103822 | Ga0133908_1038222 | F096744 | MQSFQSLEAALEAAETLGSDHYVIDRHGLQIWSPQRKLLRNEE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |