NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009940

3300009940: Microbial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R12



Overview

Basic Information
IMG/M Taxon OID3300009940 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120440 | Gp0149059 | Ga0131737
Sample NameMicrobial communities of marine sponge Rhopaloides odorabile from Great Barrier Reef, Australia - R12
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of New South Wales
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size122111335
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSponge Microbes In A High Co2 World
TypeHost-Associated
TaxonomyHost-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationDavies Reef, Great Barrier Reef, Australia
CoordinatesLat. (o)-18.833Long. (o)147.683Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004237Metagenome / Metatranscriptome447Y
F011880Metagenome / Metatranscriptome286Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0131737_1022053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1272Open in IMG/M
Ga0131737_1024092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1198Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0131737_1022053Ga0131737_10220531F011880MATREQIEAAEKKVYSQQDVGEFMTTWKDFPRPGLAAWSERKKAGLMNTARSTRYTPKFRPFDMLNVPNQSLVFLENENHRIGAESVVGVQDAFHRYVDCDMVYFQFCGNTTVETEFGVYEMTPGEVMLVPGGISHRSIGRNDSLRYFCINREAVDYVLDEEQYTSHQSFVLKRHGGPNWRGLETPNEDVRGQVVEKMHFWDDDPDDLTVVEREYDSLVGVSTLKPKQQGSGIRKLRAFDHFTMVLGKAGGEAGLLALMESQSMRVRTYNMQDEQFAFHRALQSEEVRIQFRGDALDLSEFENVAVSPGEITIIPLGISHSVISVPPDGQDFLRLNFYSKLRWHVPIDPTRHVYDSTFTVETTVHKEADWWKTAANA*
Ga0131737_1024092Ga0131737_10240921F004237MIDYDIADMMDGVKNMIEASDIRPGDQVLLLADRRSDAASMEAITAGLKFMGAEPMSLVTEPISRYGQVPQAVLEAMHACDVVIWVWPVFITFTPGHRALGRKREESDTQLQEQRMKPYFIYFEGTPGLLARDYARFPNPVLWKLAEKVREVVAAGKVVRIEDDLGSHLTASYDGTRLYGMQFRAGDPPGRCHFPWGRCGVFNGSGKADGEVFLSCVQGVAGELPAPMKWVVRDSEVVEAEGGELAEECRQLFKNVPGSNRLVEIMFGYHPKASIRHGVADPMHWELISKMPWVGLGTDRRHPDFRHVDGSVVDQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.