| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009865 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111382 | Gp0149174 | Ga0131956 |
| Sample Name | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1T |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 317411907 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine cold seep biome → cold seep → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 27.4 | Long. (o) | -93.2 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031354 | Metagenome / Metatranscriptome | 182 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0131956_100035587 | Not Available | 758 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0131956_100035587 | Ga0131956_1000355872 | F031354 | LKTTIDINDILYPIINVASVKTTIDGGVYRNKKPLNSELRDIVIIPLSNYVGDEIMNEATFMVNCYCKNFTNGTPDITKLRAIVNAVVAVIEAYNNTSNYYIFEITNQILLQD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |