NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009861

3300009861: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 3, 6m depth; RNA IDBA-UD



Overview

Basic Information
IMG/M Taxon OID3300009861 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116874 | Gp0151116 | Ga0132184
Sample NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 3, 6m depth; RNA IDBA-UD
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3240421
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomemeromictic pondpond water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)N/ADepth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003081Metagenome / Metatranscriptome508Y
F007964Metagenome / Metatranscriptome341Y
F060948Metagenome / Metatranscriptome132Y
F085704Metagenome / Metatranscriptome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0132184_100175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1056Open in IMG/M
Ga0132184_100401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea774Open in IMG/M
Ga0132184_100724Not Available625Open in IMG/M
Ga0132184_100779Not Available610Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0132184_100175Ga0132184_1001751F003081GLVIELREEMFNNTRFGAEVFYMHVRGVDTLMVLSYLHILKKIYLKNYVTAESDG*
Ga0132184_100401Ga0132184_1004011F060948VFFGLALCCTHLSEITLTIAANIMHTFFFFYGKFYWWLFTDKQLCSDTLIRLAYGHYVIAFYLGYASFIHTIDMHYDWKNETAMDGMAANLT*
Ga0132184_100724Ga0132184_1007242F007964MANAYTDTSSGSFGGTVGGAGLVQKAYDRLLEFALRSEPLIRSVADK
Ga0132184_100779Ga0132184_1007791F085704DHNIATAGIIDESAFLVAPNSVYVWESPVTNLRVNVLTSGEIEINMYGYLAIHASAAGAGIRRYNLA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.