x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300009859
3300009859: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, Depth 8m; RNA IDBA-UD
Overview
| Basic Information |
| IMG/M Taxon OID | 3300009859 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0116874 | Gp0151143 | Ga0132191 |
| Sample Name | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 4, Depth 8m; RNA IDBA-UD |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Marine Biological Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 7718747 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → Viruses | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
| Location Information |
| Location | Falmouth, Massachusetts |
| Coordinates | Lat. (o) | 41.548517 | Long. (o) | -70.622961 | Alt. (m) | N/A | Depth (m) | 8 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F004260 | Metagenome / Metatranscriptome | 446 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0132191_102658 | Ga0132191_1026582 | F004260 | MNLETHLLNTLKAKQQTYALEALKRPQARDAFEYGFRAGTIAGLEAAIEVLLTLIDEEKNGNNDF* |
