Sample 3300009594

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300009594

3300009594: Groundwater microbial communities from Devils Hole, Nevada to study Microbial Dark Matter (Phase II) - Devils Hole

Overview

Basic Information
IMG/M Taxon OID	3300009594 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0111485 \| Gp0134299 \| Ga0114941
Sample Name	Groundwater microbial communities from Devils Hole, Nevada to study Microbial Dark Matter (Phase II) - Devils Hole
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	32867632
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater biome → cave → groundwater
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline)

Location Information
Location	Devils Hole, Nevada
Coordinates	Lat. (^o)	36.43	Long. (^o)	-116.29	Alt. (m)	N/A	Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080645	Metagenome / Metatranscriptome	115	Y
F088534	Metagenome / Metatranscriptome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0114941_112210	Not Available	554	Open in IMG/M
Ga0114941_113925	Not Available	516	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0114941_112210	Ga0114941_1122101	F080645	QTLMTKLLTSEQISDLCQAHCYRVIENMDMDDLVSYAVQMMYQSFDKNPGQNDTDVDMLIEDIWVAEGEDDDSTEEFISGIVGSELASEIVKTTQF*
Ga0114941_113925	Ga0114941_1139252	F088534	MFSTTLTNPKTFGNTYQWAILSILPMDSDKNRHGLNSPEIKSALGLSNAARTSLCLMLKEMAGKGLVQRYDLKIGNRRIVSYKRLLPLRKREQIARLIRGV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.