NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009594

3300009594: Groundwater microbial communities from Devils Hole, Nevada to study Microbial Dark Matter (Phase II) - Devils Hole



Overview

Basic Information
IMG/M Taxon OID3300009594 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111485 | Gp0134299 | Ga0114941
Sample NameGroundwater microbial communities from Devils Hole, Nevada to study Microbial Dark Matter (Phase II) - Devils Hole
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size32867632
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomecavegroundwater
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationDevils Hole, Nevada
CoordinatesLat. (o)36.43Long. (o)-116.29Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080645Metagenome / Metatranscriptome115Y
F088534Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0114941_112210Not Available554Open in IMG/M
Ga0114941_113925Not Available516Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0114941_112210Ga0114941_1122101F080645QTLMTKLLTSEQISDLCQAHCYRVIENMDMDDLVSYAVQMMYQSFDKNPGQNDTDVDMLIEDIWVAEGEDDDSTEEFISGIVGSELASEIVKTTQF*
Ga0114941_113925Ga0114941_1139252F088534MFSTTLTNPKTFGNTYQWAILSILPMDSDKNRHGLNSPEIKSALGLSNAARTSLCLMLKEMAGKGLVQRYDLKIGNRRIVSYKRLLPLRKREQIARLIRGV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.