NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009558

3300009558: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; RNA IDBA-UD



Overview

Basic Information
IMG/M Taxon OID3300009558 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116874 | Gp0147226 | Ga0130023
Sample NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 12m depth; RNA IDBA-UD
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size39142879
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomemeromictic pondpond water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)N/ADepth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F072114Metagenome / Metatranscriptome121N
F080037Metagenome / Metatranscriptome115Y
F097314Metagenome / Metatranscriptome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0130023_102211All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1173Open in IMG/M
Ga0130023_107078Not Available726Open in IMG/M
Ga0130023_118127Not Available502Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0130023_102211Ga0130023_1022112F000325MKTADGNAKLGTGCIVVSRPVGDTCPSTCIYLDKDCYALQTEKQYKNAREAGFANVITEIAKIRSMLIDAIKRGKSIRFHERGDWFLDGKLDEDYVNNVCVACESVINSGYTLPDMWFYTHIYDSRLPSKLGKYMAVYASVHNDDDMNSAKAAGFKLFAWCDSDMKIAPKRPKRKGPKRDAWHKALSKLVVLSGETFVTCPEIRKGRDFVTCTGNKDSRACKM*
Ga0130023_105087Ga0130023_1050871F097314MQVERESILRDVSRAANGATVNIQLSYTPFLNSMTNVLVLAANSGINQVSNTNANVLVFQNGQKLIPTIQYIISGSTVGINVNTHYDGANYEVVVNGVTKG*
Ga0130023_107078Ga0130023_1070781F072114NRPVMIKLFIGGQEVDLNQDQVNVTIDYSIENIDLGNISGAHSKRNVTLPATKTNVGIFQNITDAGAIVTNAYKLLSARLEADGVPILTGKARLEGADLQAINSGFLASNFKVSLIGNNADWFADVGNTLVRDLGWSTIEVNETSVKENYDPVTAEYCFILMKWKAWENETYITNNEMTPAIFIWQVLKKAFENKGYQLNSIFTTDPFNRLIIPMGLELGADYLNDFVNLRASIPSPALVSN
Ga0130023_118127Ga0130023_1181271F080037MTQALAYAAAIRDNAQDDGQPIPMDLVISFEDDYNKIIASPGLGI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.