NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009557

3300009557: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; RNA IDBA-UD



Overview

Basic Information
IMG/M Taxon OID3300009557 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116874 | Gp0147224 | Ga0130021
Sample NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; RNA IDBA-UD
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17718468
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Cryptophyceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomemeromictic pondpond water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationSiders Pond, Falmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)N/ADepth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025879Metagenome / Metatranscriptome200Y
F026478Metagenome / Metatranscriptome197Y
F069988Metagenome / Metatranscriptome123Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0130021_101541Not Available1069Open in IMG/M
Ga0130021_103797Not Available700Open in IMG/M
Ga0130021_108268All Organisms → cellular organisms → Eukaryota → Cryptophyceae501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0130021_101541Ga0130021_1015412F025879YKGYPDFLKLMREFRIQRTDFDVWIPQLTGKSPESWIDNTKVPKHEYYTKLQYCKVGVQMRQSNYGWSVSGTDCMMNGTPMIFHDSLCYREIDPSGLFFKYKKDFFNLLNSFLDDDEFRIKHELRSIERAKELSSNEANMIKQLHKKLN*
Ga0130021_103797Ga0130021_1037971F069988VIYLKNERWFELPKSKDIDEPKVKPKQRINPYAA*
Ga0130021_108268Ga0130021_1082681F026478LPLLLALAFCVLLGAAAQKPKRKTVSITDPDVLKAKEFALKEIIKLTDSYRDMKVNKILKAETARSAFADGTNYFLKLELECVSICAAPLSPASTCRRGKYKGGNEVIVFEKDDGHYDGIAIDEFPQMDGEYHPCTPSYKGPEKCNPAEHRTPEQAALFADD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.