Sample 3300009490

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300009490

3300009490: Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS852 no min length

Overview

Basic Information
IMG/M Taxon OID	3300009490 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0114926 \| Gp0118616 \| Ga0119764
Sample Name	Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - FS852 no min length
Sequencing Status	Permanent Draft
Sequencing Center	Marine Biological Laboratory
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	214100442
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Marine Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Mid-Cayman Rise
Coordinates	Lat. (^o)	18.547101	Long. (^o)	-81.71817	Alt. (m)	N/A	Depth (m)	4986
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079221	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0119764_10800287	Not Available	521	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0119764_10800287	Ga0119764_108002871	F079221	MGLQWLQGTNVSARNTWECAFCRRRSRVDRRIVLTIDNGRAGQQRVRCCDLECLRRLLALWEE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.