| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009398 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118565 | Gp0137166 | Ga0115921 |
| Sample Name | Microbial communities from sand-filter backwash in Singapore swimming pools - JW-2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 165808734 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities In Swimming Pool Backwashes |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash → Microbial Communities In Swimming Pool Backwashes |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Singapore | |||||||
| Coordinates | Lat. (o) | 1.28967 | Long. (o) | 103.85007 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F077438 | Metagenome / Metatranscriptome | 117 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0115921_1137225 | Not Available | 620 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0115921_1137225 | Ga0115921_11372252 | F077438 | VYSTERVELSFRESRFETLFLWNLQVEISSALGPKAEKEISSYKN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |