


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009355 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117975 | Gp0126377 | Ga0103788 |
| Sample Name | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone3_total_RNA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Florida |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 52622272 |
| Sequencing Scaffolds | 7 |
| Novel Protein Genes | 7 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 4 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Eukaryota | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → cay → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Highborne Cay, Bahamas | |||||||
| Coordinates | Lat. (o) | 24.72 | Long. (o) | -76.82 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001926 | Metagenome / Metatranscriptome | 616 | Y |
| F030135 | Metagenome / Metatranscriptome | 186 | Y |
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
| F047147 | Metagenome / Metatranscriptome | 150 | Y |
| F060086 | Metagenome / Metatranscriptome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103788_1002370 | Not Available | 998 | Open in IMG/M |
| Ga0103788_1002506 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| Ga0103788_1003174 | Not Available | 900 | Open in IMG/M |
| Ga0103788_1003506 | All Organisms → cellular organisms → Eukaryota | 870 | Open in IMG/M |
| Ga0103788_1004707 | Not Available | 782 | Open in IMG/M |
| Ga0103788_1005087 | Not Available | 760 | Open in IMG/M |
| Ga0103788_1008798 | All Organisms → cellular organisms → Eukaryota → Sar | 619 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103788_1002370 | Ga0103788_10023701 | F047147 | MAVTKGLVREEQLLEDMCLLGSMTMEIAQILTLH* |
| Ga0103788_1002506 | Ga0103788_10025062 | F037503 | MPLGAASDLSLAEVELLIGLEGFTAYQPLTNSECCKIYPGVSAWVLRSVREREITQTIS* |
| Ga0103788_1003174 | Ga0103788_10031741 | F047147 | AIIVAVTEGPVREEQLLHDLCLLGAVTVEITQILTRAGFA* |
| Ga0103788_1003506 | Ga0103788_10035062 | F060086 | GQEDPFELDSILLLSIGQHGEDSKRQYIYLYNHETPLLAGLIDLLY* |
| Ga0103788_1004707 | Ga0103788_10047071 | F030135 | IAPEGLKDREELATLSSTTDIWHSTYAGCQFPDAILPGWEAFDLVAGPLN* |
| Ga0103788_1005087 | Ga0103788_10050871 | F030135 | IAPEGLKDREELATLSSTTDIWHSTFVGRQFPDAILPGTEAFDLVAGPLS* |
| Ga0103788_1008798 | Ga0103788_10087981 | F001926 | VRHEDIPEINKPKIRFAVLEGDKLMKEVDNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLTLGYTTSGDP* |
| ⦗Top⦘ |