| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009349 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117975 | Gp0126376 | Ga0103787 |
| Sample Name | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone2_mRNA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Florida |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 47660432 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa → Microcystis aeruginosa PCC 7806 | 1 |
| All Organisms → cellular organisms → Eukaryota | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → cay → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Highborne Cay, Bahamas | |||||||
| Coordinates | Lat. (o) | 24.72 | Long. (o) | -76.82 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001679 | Metagenome / Metatranscriptome | 653 | Y |
| F060086 | Metagenome / Metatranscriptome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103787_1007408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa → Microcystis aeruginosa PCC 7806 | 757 | Open in IMG/M |
| Ga0103787_1008969 | All Organisms → cellular organisms → Eukaryota | 687 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103787_1007408 | Ga0103787_10074082 | F001679 | VWGMSRRQKAMKGVEDCEKPRGLVKRELIRGSLNDVH* |
| Ga0103787_1008969 | Ga0103787_10089691 | F060086 | ILLLSIGQHGEDRKRQYFMYNHETPLLADLIDLLY* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |