| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009096 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053064 | Gp0104124 | Ga0058712 |
| Sample Name | Bulk soil microbial communities from Harvard Forest, USA - 5Bulk_unsorted metaG |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 939084 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | forest biome → land → bulk soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Harvard Forest, Massachusetts, USA | |||||||
| Coordinates | Lat. (o) | 42.5502 | Long. (o) | -72.1737 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049516 | Metagenome / Metatranscriptome | 146 | Y |
| F071286 | Metagenome / Metatranscriptome | 122 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0058712_10077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| Ga0058712_10104 | Not Available | 563 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0058712_10077 | Ga0058712_100771 | F071286 | MNKPRLALVAIGWLLAAGASAQPAGSSTPAPTGLVVGSGNFFSPIVGNLDRAIEFYRDGIGLDVAGQPSNADANLPLRKMFGLPDAQIRWTVGRPPGMRSGVEIVEIAKAAGKPAER |
| Ga0058712_10104 | Ga0058712_101041 | F049516 | MLKRLSPHNRILIKEVLRRVDRGAADLNVLLVVVAIGLAALDMTFLVTQKVVDNLPPITRVSYDQAPPTAK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |