x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300009047
3300009047: Combined Assembly of De NOVO T14 (BES) Tyne Sediment Benzoate Gp0125122, Gp0125123, Gp0125658
Overview
Basic Information
IMG/M Taxon OID 3300009047 Open in IMG/M GOLD Reference Gs0117429 | Gp0125122 | Ga0116019 Sample Name Combined Assembly of De NOVO T14 (BES) Tyne Sediment Benzoate Gp0125122, Gp0125123, Gp0125658 Sequencing Status Permanent Draft Sequencing Center Shell Corporation Published? N Use Policy Open
Dataset Contents
Total Genome Size 230185399 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom Type Environmental Taxonomy Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Sediment (non-saline)
Location Information
Location UK (Newcastle upon Tyne) Coordinates Lat. (o ) 54.971158 Long. (o ) -1.703654 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F106197 Metagenome / Metatranscriptome 100 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0116019_10023470 All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 735 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0116019_10023470 Ga0116019_100234702 F106197 VDSVSADTISAQIDSFDFLSGDWYCGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPESVYAEPGDSTYFVSPVWNIPDDAELGEYQADFYLYGYYDSRTGELSEQLDQVDQVRAFSVVG*
