NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009047

3300009047: Combined Assembly of De NOVO T14 (BES) Tyne Sediment Benzoate Gp0125122, Gp0125123, Gp0125658



Overview

Basic Information
IMG/M Taxon OID3300009047 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0125122 | Ga0116019
Sample NameCombined Assembly of De NOVO T14 (BES) Tyne Sediment Benzoate Gp0125122, Gp0125123, Gp0125658
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size230185399
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F106197Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0116019_10023470All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112735Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0116019_10023470Ga0116019_100234702F106197VDSVSADTISAQIDSFDFLSGDWYCGSNQGGANVWIKNTGDVGHLFWVSYEVMDRRGQWYSAPPESVYAEPGDSTYFVSPVWNIPDDAELGEYQADFYLYGYYDSRTGELSEQLDQVDQVRAFSVVG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.