x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300008997
3300008997: Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7um, replicate b
Overview
Basic Information
IMG/M Taxon OID 3300008997 Open in IMG/M GOLD Reference Gs0118094 | Gp0127931 | Ga0115662 Sample Name Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 250-2.7um, replicate b Sequencing Status Permanent Draft Sequencing Center Georgia Genomics Facility Published? N Use Policy Open
Dataset Contents
Total Genome Size 800879438 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela Type Environmental Taxonomy Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela
Location Information
Location Cariaco Basin, Venezuela Coordinates Lat. (o ) 10.5 Long. (o ) -64.66 Alt. (m) N/A Depth (m) 200 Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F068724 Metagenome / Metatranscriptome 124 N
Sequences
Scaffold ID Protein ID Family Sequence
Ga0115662_1006566 Ga0115662_100656615 F068724 MTQHHGRVEKMRVGIPALFSVEVDYYKDLENVGPTGQMTAEEEIKYWLSKGRDPYIMNPKLPLPQIKAATKLMDRD*
