Sample 3300008987

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008987

3300008987: Combined Assembly of De NOVO T34 (live) FTP Oil sands Benzoate Gp0125668, Gp0125720, Gp0125669

Overview

Basic Information
IMG/M Taxon OID	3300008987 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117890 \| Gp0125668 \| Ga0116022
Sample Name	Combined Assembly of De NOVO T34 (live) FTP Oil sands Benzoate Gp0125668, Gp0125720, Gp0125669
Sequencing Status	Permanent Draft
Sequencing Center	Shell Corporation
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	142506679
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada
Type	Environmental
Taxonomy	Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Alberta, Canada
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030405	Metagenome / Metatranscriptome	185	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0116022_1000011	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	204401	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116022_1000011	Ga0116022_1000011170	F030405	MHRGGGACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.