NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008982

3300008982: Combined Assembly of De NOVO T5 (live) Tyne Sediment Benzoate Gp0125094, Gp0125095, Gp0125096



Overview

Basic Information
IMG/M Taxon OID3300008982 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117429 | Gp0125094 | Ga0116011
Sample NameCombined Assembly of De NOVO T5 (live) Tyne Sediment Benzoate Gp0125094, Gp0125095, Gp0125096
Sequencing StatusPermanent Draft
Sequencing CenterShell Corporation
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size189266441
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSyntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUK (Newcastle upon Tyne)
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050029Metagenome / Metatranscriptome146Y
F059489Metagenome / Metatranscriptome134Y
F064732Metagenome / Metatranscriptome128Y
F091072Metagenome / Metatranscriptome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0116011_1002508All Organisms → cellular organisms → Bacteria → Proteobacteria3393Open in IMG/M
Ga0116011_1008567Not Available1545Open in IMG/M
Ga0116011_1019228All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112879Open in IMG/M
Ga0116011_1116113All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon561Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0116011_1002508Ga0116011_10025084F050029MIRTRGENMATIVIHWKDKEIPPMELKAAAYKGADSSIIKITSNGKDYWFNWGECWFLETTSTE*
Ga0116011_1008567Ga0116011_10085674F064732AALAAARERCTMPPAQSAERHVRFPSSPMDPGRFIAAIVTRSTSPPGRPEDTDQIDALSDLFLSEYHLMGI*
Ga0116011_1019228Ga0116011_10192281F091072MAGTVKETIAPICKETEEDIKALLKGTDVAWAQYKRCHGTKVTDTKELDEFLDSL*
Ga0116011_1116113Ga0116011_11161131F059489MTQSNDQHAVDVDTYISKNSRVKSFVYDRGEIRTIAENLGFKTDHVRTELRKLGYSLIKNSSHGRMIWK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.