| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008948 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117429 | Gp0125121 | Ga0116018 |
| Sample Name | Combined Assembly of De NOVO T10 (BES) Tyne Sediment Benzoate Gp0125656, Gp0125657, Gp0125121 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 220020862 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | UK (Newcastle upon Tyne) | |||||||
| Coordinates | Lat. (o) | 54.971158 | Long. (o) | -1.703654 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030405 | Metagenome / Metatranscriptome | 185 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0116018_1044217 | Not Available | 510 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0116018_1044217 | Ga0116018_10442171 | F030405 | LQDYDVDLFILALAKTVTPGGGPRREPGQAAPPTT* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |