NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008926

3300008926: Microbial communities from freshwater in the western basin of Lake Erie, USA - 973-2



Overview

Basic Information
IMG/M Taxon OID3300008926 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117964 | Gp0126293 | Ga0103704
Sample NameMicrobial communities from freshwater in the western basin of Lake Erie, USA - 973-2
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Tennessee
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7010967
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Freshwater In The Western Basin Of Lake Erie, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
Locationwestern basin of Lake Erie, USA
CoordinatesLat. (o)41.79Long. (o)-83.33Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030134Metagenome / Metatranscriptome186Y
F060948Metagenome / Metatranscriptome132Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103704_101482Not Available1139Open in IMG/M
Ga0103704_101880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata902Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103704_101482Ga0103704_1014821F030134ITPHEIIVEVNSFRTKTTKLKKDKIQPVLRRFKLRSCNFLLVEQTNNLCCYNIDDKIIQHRGSR*
Ga0103704_101880Ga0103704_1018801F060948LCCTHLSDVTLTIAKNAFRTFFLFIGKVEWLLFTDGMLNSDTVIRLAYAHYVVAFYLFFLGLSHGIDMHYD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.