| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008926 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117964 | Gp0126293 | Ga0103704 |
| Sample Name | Microbial communities from freshwater in the western basin of Lake Erie, USA - 973-2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Tennessee |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 7010967 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Microbial Communities From Freshwater In The Western Basin Of Lake Erie, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater lake biome → freshwater lake → lake water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | western basin of Lake Erie, USA | |||||||
| Coordinates | Lat. (o) | 41.79 | Long. (o) | -83.33 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030134 | Metagenome / Metatranscriptome | 186 | Y |
| F060948 | Metagenome / Metatranscriptome | 132 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103704_101482 | Not Available | 1139 | Open in IMG/M |
| Ga0103704_101880 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata | 902 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103704_101482 | Ga0103704_1014821 | F030134 | ITPHEIIVEVNSFRTKTTKLKKDKIQPVLRRFKLRSCNFLLVEQTNNLCCYNIDDKIIQHRGSR* |
| Ga0103704_101880 | Ga0103704_1018801 | F060948 | LCCTHLSDVTLTIAKNAFRTFFLFIGKVEWLLFTDGMLNSDTVIRLAYAHYVVAFYLFFLGLSHGIDMHYD* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |