NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008885

3300008885: Microbial communities associated with green microalga Chlorella saccharophila, Germany - (MZCH: 10155)



Overview

Basic Information
IMG/M Taxon OID3300008885 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118520 | Gp0137009 | Ga0115910
Sample NameMicrobial communities associated with green microalga Chlorella saccharophila, Germany - (MZCH: 10155)
Sequencing StatusPermanent Draft
Sequencing CenterHPI Heinrich-Pette-Institut
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size174773623
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Associated With Green Microalga Chlorella Saccharophila, Germany - (Mzch: 10155)
TypeHost-Associated
TaxonomyHost-Associated → Microbial → Bacteria → Unclassified → Unclassified → Chlorella Sacherophilia (Mzch 10155) Associated → Microbial Communities Associated With Green Microalga Chlorella Saccharophila, Germany - (Mzch: 10155)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant corpus

Location Information
LocationGermany
CoordinatesLat. (o)53.560155Long. (o)9.859606Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029122Metagenome / Metatranscriptome189N
F097276Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115910_159371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria697Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115910_155090Ga0115910_1550901F097276MIKARLAIVGASILSVGAAPADMLPLKQGIFVPVGSACKGASNAEMVNYWGGKSSIGVAQATCTIKKLVKAGTTYTVTDLCKDLQSGYAIDGEPRVLKIASPTQFSMDGTSYRYCGPKPQW*
Ga0115910_159371Ga0115910_1593711F029122MLIRPAISDTDPIRHRRPTPDGQFSGNIIDEAMRPFARRG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.