Sample 3300008885

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008885

3300008885: Microbial communities associated with green microalga Chlorella saccharophila, Germany - (MZCH: 10155)

Overview

Basic Information
IMG/M Taxon OID	3300008885 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118520 \| Gp0137009 \| Ga0115910
Sample Name	Microbial communities associated with green microalga Chlorella saccharophila, Germany - (MZCH: 10155)
Sequencing Status	Permanent Draft
Sequencing Center	HPI Heinrich-Pette-Institut
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	174773623
Sequencing Scaffolds	1
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities Associated With Green Microalga Chlorella Saccharophila, Germany - (Mzch: 10155)
Type	Host-Associated
Taxonomy	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Chlorella Sacherophilia (Mzch 10155) Associated → Microbial Communities Associated With Green Microalga Chlorella Saccharophila, Germany - (Mzch: 10155)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant corpus

Location Information
Location	Germany
Coordinates	Lat. (^o)	53.560155	Long. (^o)	9.859606	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029122	Metagenome / Metatranscriptome	189	N
F097276	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0115910_159371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	697	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0115910_155090	Ga0115910_1550901	F097276	MIKARLAIVGASILSVGAAPADMLPLKQGIFVPVGSACKGASNAEMVNYWGGKSSIGVAQATCTIKKLVKAGTTYTVTDLCKDLQSGYAIDGEPRVLKIASPTQFSMDGTSYRYCGPKPQW*
Ga0115910_159371	Ga0115910_1593711	F029122	MLIRPAISDTDPIRHRRPTPDGQFSGNIIDEAMRPFARRG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.