NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008874

3300008874: Microbial communities of Wadden Sea tidal flat in Germany - 1250 highTide



Overview

Basic Information
IMG/M Taxon OID3300008874 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117938 | Gp0125976 | Ga0103387
Sample NameMicrobial communities of Wadden Sea tidal flat in Germany - 1250 highTide
Sequencing StatusPermanent Draft
Sequencing CenterBielefeld University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3522341
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Wadden Sea Tidal Flat In Germany
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationWadden Sea, Germany
CoordinatesLat. (o)53.73Long. (o)7.67Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060086Metagenome / Metatranscriptome133Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103387_100229All Organisms → cellular organisms → Eukaryota626Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103387_100229Ga0103387_1002291F060086FELDSNLLLSSGRHGEDRKRQYALYVYNHETPLLDDLADLLYIYSIEYYYT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.