Basic Information | |
---|---|
IMG/M Taxon OID | 3300008874 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117938 | Gp0125976 | Ga0103387 |
Sample Name | Microbial communities of Wadden Sea tidal flat in Germany - 1250 highTide |
Sequencing Status | Permanent Draft |
Sequencing Center | Bielefeld University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 3522341 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Microbial Communities Of Wadden Sea Tidal Flat In Germany |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Wadden Sea, Germany | |||||||
Coordinates | Lat. (o) | 53.73 | Long. (o) | 7.67 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060086 | Metagenome / Metatranscriptome | 133 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0103387_100229 | All Organisms → cellular organisms → Eukaryota | 626 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0103387_100229 | Ga0103387_1002291 | F060086 | FELDSNLLLSSGRHGEDRKRQYALYVYNHETPLLDDLADLLYIYSIEYYYT* |
⦗Top⦘ |