| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008790 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117963 | Gp0126284 | Ga0103695 |
| Sample Name | Microbial communities from seawater in eastern North Pacific Ocean - P8 free-living |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Georgia |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8626253 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Seawater In Eastern North Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities From Seawater In Eastern North Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | eastern North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022892 | Metagenome / Metatranscriptome | 212 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103695_100624 | Not Available | 655 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103695_100624 | Ga0103695_1006241 | F022892 | PLAKSIGVFKTILPPNIVAIQLKILIPVGTAIIIVAAVK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |