| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008776 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117950 | Gp0126180 | Ga0103591 |
| Sample Name | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_0.2-1.6micron |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Georgia Institute of Technology |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1778728 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED161 | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine oxygen minimum zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 18.9 | Long. (o) | -104.5 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008649 | Metagenome / Metatranscriptome | 330 | Y |
| F025846 | Metagenome / Metatranscriptome | 200 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103591_10287 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED161 | 841 | Open in IMG/M |
| Ga0103591_11046 | Not Available | 538 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103591_10287 | Ga0103591_102873 | F025846 | MTVLQAVLMVNLTVAMDLVSMAHGHVTAMVTVLMAQTKLTVLLHHVKTKVYLIVVMDNVFQHHMYVMDQVNFVTQDGVLTVPMAQMKA* |
| Ga0103591_11046 | Ga0103591_110462 | F008649 | MTELETLMLDVTNTLNHNGFDNVQITPQGGEDFSIRVGYWDIIPASLIETMEEYHSIRITEHDWEDEDCGTLYRYLVEPVDENSGYTLNELNELDSHYTEEALYLESVGADDCWGVA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |