| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008724 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117975 | Gp0126374 | Ga0103785 |
| Sample Name | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_mRNA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Florida |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 25119553 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → cay → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Highborne Cay, Bahamas | |||||||
| Coordinates | Lat. (o) | 24.72 | Long. (o) | -76.82 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022892 | Metagenome / Metatranscriptome | 212 | Y |
| F027186 | Metagenome / Metatranscriptome | 195 | Y |
| F060086 | Metagenome / Metatranscriptome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103785_103089 | Not Available | 792 | Open in IMG/M |
| Ga0103785_104880 | Not Available | 617 | Open in IMG/M |
| Ga0103785_105520 | Not Available | 577 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103785_103089 | Ga0103785_1030892 | F060086 | LDSNLLLSSGRHGEDCKRQYIFIYIYVHETPLLIDLADLMY* |
| Ga0103785_104880 | Ga0103785_1048802 | F022892 | VNKKIKPKANNIGVLNVKEPSHIVAIQLNILIPVGTAIIIVAAVK* |
| Ga0103785_105520 | Ga0103785_1055202 | F027186 | MTTNSNFNFTNNTAITLELPFSEHIEELRQRIFVVF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |