Basic Information | |
---|---|
IMG/M Taxon OID | 3300008724 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117975 | Gp0126374 | Ga0103785 |
Sample Name | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_mRNA |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Florida |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 25119553 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 3 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → cay → microbial mat material |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Highborne Cay, Bahamas | |||||||
Coordinates | Lat. (o) | 24.72 | Long. (o) | -76.82 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022892 | Metagenome / Metatranscriptome | 212 | Y |
F027186 | Metagenome / Metatranscriptome | 195 | Y |
F060086 | Metagenome / Metatranscriptome | 133 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0103785_103089 | Not Available | 792 | Open in IMG/M |
Ga0103785_104880 | Not Available | 617 | Open in IMG/M |
Ga0103785_105520 | Not Available | 577 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0103785_103089 | Ga0103785_1030892 | F060086 | LDSNLLLSSGRHGEDCKRQYIFIYIYVHETPLLIDLADLMY* |
Ga0103785_104880 | Ga0103785_1048802 | F022892 | VNKKIKPKANNIGVLNVKEPSHIVAIQLNILIPVGTAIIIVAAVK* |
Ga0103785_105520 | Ga0103785_1055202 | F027186 | MTTNSNFNFTNNTAITLELPFSEHIEELRQRIFVVF |
⦗Top⦘ |