| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008699 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117953 | Gp0126206 | Ga0103617 |
| Sample Name | Microbial communities of saline water collected from the North Sea in Germany - HE327_1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Goettingen Genomics Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8480883 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Saline Water Collected From The North Sea In Germany |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Sea, Germany | |||||||
| Coordinates | Lat. (o) | 53.8955 | Long. (o) | 8.0496 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022656 | Metagenome / Metatranscriptome | 213 | Y |
| F095520 | Metagenome / Metatranscriptome | 105 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103617_100413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 989 | Open in IMG/M |
| Ga0103617_101642 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium | 559 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103617_100413 | Ga0103617_1004131 | F095520 | MKRNIDQVDSTRGRSSLTALLILCLSLSGMGGHVHAMIAVTDSGGFEDHHNEMPGMSHHDGHEMRLAMMASTDADESCCQDQASCHCSAIPQFLGASNETPPLNSVMPQRSPKVSDFIFDIVPPPPKSA* |
| Ga0103617_101642 | Ga0103617_1016421 | F022656 | MKFALVALFAAVSAVTISGDPPPFQPGQSGKLGGGAYDRVTPARFSADSDDIFMRSVVQNYAQEGASKDGEPTGVFTLTESSSKALAMEVLATHKDIRGAAQAEYLATYWAKAWGHFDVNRTGSIPILYAPQLMRFLMSDQYISL* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |