NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008655

3300008655: Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Control_1a



Overview

Basic Information
IMG/M Taxon OID3300008655 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117956 | Gp0126234 | Ga0103645
Sample NameMicrobial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Control_1a
Sequencing StatusPermanent Draft
Sequencing CenterAuburn University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size8367768
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomerhizospheresoil
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationOhio, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001679Metagenome / Metatranscriptome653Y
F061584Metagenome / Metatranscriptome131Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103645_100316Not Available635Open in IMG/M
Ga0103645_100823Not Available513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103645_100316Ga0103645_1003161F061584SSGINAEYCLTHRFPFGGSRTWCGIPRPRRRAAVTSHEVGRSTECCERRSCKRIGLLAPSMTSLFPASLSGVTSPPAPVLLRVRVHPPMSFTSPTEYEPLQTCPARFRAKRLPWGFPPHRGISIQSPLPTELPRSRSHVPPSAFLAPSTVCSSAHLAGLFHPTATSGIHLPGVISRCQAESPRR*
Ga0103645_100823Ga0103645_1008232F001679MSRRQKAMKGVEGCDKLGEAVKQALIPRYPNHSMLNT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.