Sample 3300008655

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008655

3300008655: Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Control_1a

Overview

Basic Information
IMG/M Taxon OID	3300008655 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117956 \| Gp0126234 \| Ga0103645
Sample Name	Microbial communities of soybean rhizosphere soil from Ohio, USA - Soybean_Control_1a
Sequencing Status	Permanent Draft
Sequencing Center	Auburn University
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	8367768
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	terrestrial biome → rhizosphere → soil
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere

Location Information
Location	Ohio, USA
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001679	Metagenome / Metatranscriptome	653	Y
F061584	Metagenome / Metatranscriptome	131	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103645_100316	Not Available	635	Open in IMG/M
Ga0103645_100823	Not Available	513	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103645_100316	Ga0103645_1003161	F061584	SSGINAEYCLTHRFPFGGSRTWCGIPRPRRRAAVTSHEVGRSTECCERRSCKRIGLLAPSMTSLFPASLSGVTSPPAPVLLRVRVHPPMSFTSPTEYEPLQTCPARFRAKRLPWGFPPHRGISIQSPLPTELPRSRSHVPPSAFLAPSTVCSSAHLAGLFHPTATSGIHLPGVISRCQAESPRR*
Ga0103645_100823	Ga0103645_1008232	F001679	MSRRQKAMKGVEGCDKLGEAVKQALIPRYPNHSMLNT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.