NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008644

3300008644: Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-08-50



Overview

Basic Information
IMG/M Taxon OID3300008644 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117952 | Gp0126197 | Ga0103608
Sample NameMicrobial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-08-50
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Michigan
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size34277879
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia1
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010686Metagenome / Metatranscriptome300Y
F025846Metagenome / Metatranscriptome200Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103608_1000730All Organisms → Viruses → Predicted Viral1499Open in IMG/M
Ga0103608_1004060All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia715Open in IMG/M
Ga0103608_1005149All Organisms → cellular organisms → Bacteria638Open in IMG/M
Ga0103608_1007676All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium530Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103608_1000730Ga0103608_10007303F025846MASVSMPHGSVMDMQTVQMVVMKLTVLLHHVKTRVYGIVVMDNASLHPMYVMAQVNFVTQAGLLTVPMVQMKA*
Ga0103608_1004060Ga0103608_10040603F025846VNLTVAMDLVSMAPGHVTAMVTVLMAQMKLTVLLHHVKTKVYGIVAMANVFQHHMYVMDQVNFVMQVGVLTVLMAQMKA*
Ga0103608_1005149Ga0103608_10051491F010686TGGTGRGRNHCGQATKGVWGMSWRQKAMKGAEGCEKPGEAVKRALIPGFLNYVALNT*
Ga0103608_1007676Ga0103608_10076762F025846MAVHMVSVFMRAGPVMAQQTAMMAQMKQTVLLHHVKTKVYGIVVMDNVFQHPMYVMAQVNFVTQAGLQTVPMAQMKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.