NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008598

3300008598: Planktonic microbial communities from coastal waters of California, USA - Canon-40



Overview

Basic Information
IMG/M Taxon OID3300008598 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117987 | Gp0126524 | Ga0103935
Sample NamePlanktonic microbial communities from coastal waters of California, USA - Canon-40
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Hawaii
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1735867
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePlanktonic Microbial Communities From Coastal Waters Of California, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecoastal water bodycoastal sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationPacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000075Metagenome / Metatranscriptome2622Y
F005505Metagenome / Metatranscriptome398Y
F030108Metagenome / Metatranscriptome186Y
F049026Metagenome / Metatranscriptome147Y
F101265Metagenome / Metatranscriptome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103935_11213Not Available567Open in IMG/M
Ga0103935_11429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata535Open in IMG/M
Ga0103935_11448Not Available532Open in IMG/M
Ga0103935_11575Not Available513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103935_11049Ga0103935_110491F000075LIAAVSATQYDSMTEDELLVNLESTLNSAQRSEARGDGDAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK*
Ga0103935_11213Ga0103935_112131F049026GDGIDEVAAGEGTPSEDLSNAMAAYSAAISQTKDIKLSNK*
Ga0103935_11429Ga0103935_114291F005505GTYVS*FYDAFLKEIQDA*Y*VLYVYVYFFIHHFEGVTVNYFFFER*NIAEMDEIRYYGVAPH*YFRPLMGMLIVCPTHYEGVF*LMFYLVLLAMLPIFYNFYNTYNKHVASIPMQNSLLQTTAFILFMMSLYCTASILPCGRYYYEPEGGYVGNP*IKFSYQYIYLYLA*IIHHLDV
Ga0103935_11448Ga0103935_114482F101265SSLGGNEISGLKLATDLRLKRIYHCRITDVGEDYDLRIIISKSIGVYIVKTTSSEIVEAN
Ga0103935_11575Ga0103935_115751F030108FMAFGAKAADFSGSVGVSSDNYFRGVNISDGAGYSVKGLVDLDNGIFAGASVMSLDDRTDLMTKAVIGYGRDLGGVKVDVAYIDYGYQGLSLDGWEEVAVKAYFDKFAVQYSKGLDNAGDTYIVSSDALEIVDVAYGDSDLTGSWFEVSKSFDLAAGSVKVGYIDHELND

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.