| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008596 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117953 | Gp0126211 | Ga0103622 |
| Sample Name | Microbial communities of saline water collected from the North Sea in Germany - HE327_6 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Goettingen Genomics Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3449994 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Saline Water Collected From The North Sea In Germany |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine water body → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Sea, Germany | |||||||
| Coordinates | Lat. (o) | 54.4542 | Long. (o) | 8.0018 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027881 | Metagenome / Metatranscriptome | 193 | Y |
| F064579 | Metagenome / Metatranscriptome | 128 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103622_100157 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 902 | Open in IMG/M |
| Ga0103622_100250 | Not Available | 737 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103622_100157 | Ga0103622_1001571 | F064579 | LLSSALQASEKDDLLNTSSDIVNQITTGVTLVGAATEYAYQGDALSSGTLSTTAHISEAQVDAYNQALDNFVNNYQPYGDVKAVLENKAMGELELMDEAIGRFTEAVVDMSTVLQVNERIEEAVTPQQEAEVQTFVTESASVLQVEQETVDTYNQSVDEIETHANNASAYLAVAGSEEAVAFLEQGIENANTTAEQTNIFYDANAQWVAMGYNTTRNLTAVYLNGNDN |
| Ga0103622_100250 | Ga0103622_1002502 | F027881 | ILQTFHFMSLTVARSERVRGVLTHASLIKFYFKLNGARVSNTLKSFVKIT* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |