| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008576 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117987 | Gp0126508 | Ga0103919 |
| Sample Name | Planktonic microbial communities from coastal waters of California, USA - Canon-12 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Hawaii |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1023063 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Planktonic Microbial Communities From Coastal Waters Of California, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal water body → coastal sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003081 | Metagenome / Metatranscriptome | 508 | Y |
| F087122 | Metagenome / Metatranscriptome | 110 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103919_10396 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 880 | Open in IMG/M |
| Ga0103919_10668 | Not Available | 734 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103919_10396 | Ga0103919_103961 | F003081 | VYGNAIVVRLFLGWYYIPEPGLVIELREEMFNDTRFGSEVFYMHVRGVDSLMLLSYIHILKKIFLKNYVTSESDG* |
| Ga0103919_10668 | Ga0103919_106681 | F087122 | TQTDKLHATFDKYISAVMEGNVPKMKKVALTEGKEVTGDKTQAQAIGGSEQKTAEIFDIRRLAGLKV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |