NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008062

3300008062: Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - SG7



Overview

Basic Information
IMG/M Taxon OID3300008062 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118429 | Gp0134245 | Ga0114372
Sample NameMarine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - SG7
Sequencing StatusPermanent Draft
Sequencing CenterNational Aeronautics and Space Administration (NASA)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size121466297
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda1
Not Available2
All Organisms → cellular organisms → Archaea1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Acaryochloridaceae → Acaryochloris → unclassified Acaryochloris → Acaryochloris sp. CCMEE 54101
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Shallow-Sea Hydrothermal Vent, Milos, Greece
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Shallow-Sea Hydrothermal Vent, Milos, Greece

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biome → marine hydrothermal vent → marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMilos, Greece
CoordinatesLat. (o)36.674869Long. (o)24.520916Alt. (m)N/ADepth (m).01 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031307Metagenome183Y
F041201Metagenome / Metatranscriptome160Y
F050381Metagenome / Metatranscriptome145Y
F053659Metagenome / Metatranscriptome141Y
F056621Metagenome137Y
F070127Metagenome / Metatranscriptome123Y
F078289Metagenome / Metatranscriptome116N
F080659Metagenome115Y
F101186Metagenome102N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0114372_1001908All Organisms → cellular organisms → Bacteria1213Open in IMG/M
Ga0114372_1005287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda958Open in IMG/M
Ga0114372_1017210Not Available728Open in IMG/M
Ga0114372_1021404All Organisms → cellular organisms → Archaea689Open in IMG/M
Ga0114372_1034038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Acaryochloridaceae → Acaryochloris → unclassified Acaryochloris → Acaryochloris sp. CCMEE 5410612Open in IMG/M
Ga0114372_1034639All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria609Open in IMG/M
Ga0114372_1040773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium583Open in IMG/M
Ga0114372_1053423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium541Open in IMG/M
Ga0114372_1060673Not Available522Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0114372_1001908Ga0114372_10019081F056621MSNKEQLDFAKRVQKRIQEKHPHFRLIKRRDEIEKEFKAENDNRKS*
Ga0114372_1005287Ga0114372_10052871F101186MLSENQRKLFADFHNSVEAEGILDEKTSHMIKVAAAMAFGCYP*
Ga0114372_1017210Ga0114372_10172101F078289PLYGFNSLVRHEDIPKMREMGISQEVIQYFISNQTSSVSSEDVIKMKQSGLNNDDIMSAIKSDLYRPEQKSTSMKEAELIAKLKAAGMSDEAVLQFIKTVKSTRQVDSEGNVTQKFSNESQRTQYPTEGATFPKPDNYGYDPLNNRFLLLVKPQNQ*
Ga0114372_1021404Ga0114372_10214042F031307MGKICTYFGFKNGELVSILQTIDSNPKKAIDCNYYIAEPQEAEAQIQKWKKEKTQ*
Ga0114372_1034038Ga0114372_10340381F053659VSIAEAKPKRKNRTVTLHLGNTLTEYESAYLTNEGIQALIRQVEIADSLNWACQATRHDVDCPRLLQFTHHDSYVRSAKHFNGTQSPVTILRVRCLDCGAVFSIQPSFIIRYKRYETDALEKLMTLLFI
Ga0114372_1034639Ga0114372_10346392F041201LVQDSGGAEFKTGGILLYVEDLKRGTNKDIGPKDIFEMG
Ga0114372_1040773Ga0114372_10407731F080659MTGIPILDTILDLIMQYRLGIAMMGLAVVAVGLLMRPIAPEWSAHNRSAVATMVIGGIILVLLPTLAAASTLGSQAQ*
Ga0114372_1053423Ga0114372_10534231F070127MEELDFSITINLSLTLMEDKASINIKNVDLMPAVVSLPVRLKSQNRRASSNSEKMTIHDIILQTSKKYVVDSGQNRFTGAKLFHLSRLNHPRLKRNTFAAQVISAAPNHPSHRHYPNQKDYFFYLGKGYYKLNKKYLKIDEKQLL
Ga0114372_1060673Ga0114372_10606731F050381FPKSGSGRRNMKKLAIIMAIILLPSTALATFSIQFDNTSNKKLFYSLYWIDHPYDWPGPFNMAGGELGAREKTDLKVSYNNGKYFVIWSDKGEWQNKVMLNVNPGITSVKVTPVKSSMQK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.