NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007941

3300007941: Human posterior fornix microbial communities from NIH, USA - visit 1, subject 550534656 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007941 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053119 | Ga0114258
Sample NameHuman posterior fornix microbial communities from NIH, USA - visit 1, subject 550534656 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3202167
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Reproductive System → Vagina → Posterior Fornix → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002471Metagenome / Metatranscriptome556Y
F002994Metagenome / Metatranscriptome514Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0114258_10271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea847Open in IMG/M
Ga0114258_10495Not Available602Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0114258_10271Ga0114258_102712F002471MASSAKKNHAFLYHDRKNSRNVFRSYDAFDSHAMFASSSSYVHNRNVGRRNVVHNMPRRDVVNVPRKVNEPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEIVTNLVGPNKSWVPKTQA*
Ga0114258_10495Ga0114258_104951F002994MQQKEKLNELISAIHEKDELLDTQEDFLIKENKKHVKVKNAYALEIEKCEKLSSELSTWREMIDNLRNENASLIAKVDSHVCNVSTSDPRDVNDDLLARIEELNISLASLRVENENLIAKAKDFDVCKVTISDLRDKNDILHAKIV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.