x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300007941
3300007941: Human posterior fornix microbial communities from NIH, USA - visit 1, subject 550534656 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300007941 Open in IMG/M GOLD Reference Gs0063646 | Gp0053119 | Ga0114258 Sample Name Human posterior fornix microbial communities from NIH, USA - visit 1, subject 550534656 reassembly Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 3202167 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea 1 Not Available 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Reproductive System → Vagina → Posterior Fornix → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F002471 Metagenome / Metatranscriptome 556 Y F002994 Metagenome / Metatranscriptome 514 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0114258_10271 All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea 847 Open in IMG/M Ga0114258_10495 Not Available 602 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0114258_10271 Ga0114258_102712 F002471 MASSAKKNHAFLYHDRKNSRNVFRSYDAFDSHAMFASSSSYVHNRNVGRRNVVHNMPRRDVVNVPRKVNEPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEIVTNLVGPNKSWVPKTQA* Ga0114258_10495 Ga0114258_104951 F002994 MQQKEKLNELISAIHEKDELLDTQEDFLIKENKKHVKVKNAYALEIEKCEKLSSELSTWREMIDNLRNENASLIAKVDSHVCNVSTSDPRDVNDDLLARIEELNISLASLRVENENLIAKAKDFDVCKVTISDLRDKNDILHAKIV
